PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.006G148000.1.p
Common NameSb06g022660, SORBIDRAFT_06g022660
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family MYB
Protein Properties Length: 273aa    MW: 29951.4 Da    PI: 5.6401
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.006G148000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.32.8e-161461148
                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
       Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                          +g+WT+eEd++lv+ ++ +G  +W++ ++  g+ R++k+c++rw +yl
  Sobic.006G148000.1.p 14 KGPWTPEEDKILVNHIQSFGHSNWRALPKQAGLLRCGKSCRLRWINYL 61
                          79******************************99************97 PP

2Myb_DNA-binding52.21.4e-1667112148
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
       Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                           rg++++eE++ ++ +++qlG++ W++Ia++++ gRt++++k+ w+++l
  Sobic.006G148000.1.p  67 RGNFSKEEEDAIITLHEQLGNR-WSAIAARLP-GRTDNEIKNVWHTHL 112
                           89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.0E-25564IPR009057Homeodomain-like
PROSITE profilePS5129414.878961IPR017930Myb domain
SuperFamilySSF466893.67E-3010108IPR009057Homeodomain-like
SMARTSM007177.2E-131363IPR001005SANT/Myb domain
PfamPF002491.2E-141461IPR001005SANT/Myb domain
CDDcd001671.33E-101661No hitNo description
PROSITE profilePS5129425.17862116IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.0E-2665116IPR009057Homeodomain-like
SMARTSM007173.6E-1566114IPR001005SANT/Myb domain
PfamPF002494.2E-1567112IPR001005SANT/Myb domain
CDDcd001671.20E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 273 aa     Download sequence    Send to blast
MGRAPCCEKM GLKKGPWTPE EDKILVNHIQ SFGHSNWRAL PKQAGLLRCG KSCRLRWINY  60
LRPDIKRGNF SKEEEDAIIT LHEQLGNRWS AIAARLPGRT DNEIKNVWHT HLKKRLEPTT  120
KPEEQHGAQA GGAGKKHRPK RGAAKKTTAD DVAVVPATTA PVSPERSPAS SSVTESSSMT  180
EQEQEQGNTG SSAGGFPIKE ESFTSSASDA EEFQFDDTFW SETLSMPLES FDVPMEPYDA  240
LGASSVGADG DLDYWLGVFM ESGDVHQELP QI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-261211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Sbi.33640.0callus| leaf
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0398840.0BT039884.1 Zea mays full-length cDNA clone ZM_BFc0049A07 mRNA, complete cds.
GenBankHQ8587090.0HQ858709.1 Zea mays clone UT1165 MYB transcription factor mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002448188.10.0hypothetical protein SORBIDRAFT_06g022660
SwissprotQ7XBH41e-109MYB4_ORYSJ; Myb-related protein Myb4
TrEMBLC5YCC80.0C5YCC8_SORBI; Putative uncharacterized protein Sb06g022660
STRINGSb06g022660.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP7938563
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G23250.18e-77myb domain protein 15
Publications ? help Back to Top
  1. H
    The R2R3-MYB transcription factors MYB14 and MYB15 regulate stilbene biosynthesis in Vitis vinifera.
    Plant Cell, 2013. 25(10): p. 4135-49
    [PMID:24151295]